PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan017969
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family ZF-HD
Protein Properties Length: 285aa    MW: 31615.3 Da    PI: 8.409
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-4160991PU_refplantGDBView CDS
gnl|UG|Aan#S55095573PU_unrefUnigeneView CDS
gnl|UG|Aan#S41955048PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.75e-3275127457
  ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                   rY+eClkNhAa++Gg+ +DGCgEfmps g++gt +alkCaAC+CHRnFHR+e 
    Aan017969  75 PRYRECLKNHAANMGGNITDGCGEFMPS-GDDGTLEALKCAACNCHRNFHRKEY 127
                  58*************************9.999********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-2176126IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.7E-3076126IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.0E-2976126IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.25877126IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.65E-18206274IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.1E-30211275IPR009057Homeodomain-like
TIGRFAMsTIGR015653.6E-28213269IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MALSGSHEKE FGIMHTSSPY NNNNNNNNNN NHMIRESSSE TVDHGMDPDR FHGTGASVTP  60
ISVGSKLLKS PVQIPRYREC LKNHAANMGG NITDGCGEFM PSGDDGTLEA LKCAACNCHR  120
NFHRKEYPTT SPTAGPFLQL PPPLPSPSPS PSFHHHHHHH RTPPPISLHH HPNWASSVNA  180
PPIKMAFGGA TTESSSEELN FTTGAVPPYG MAKKRFRTKF TQDQKEKMLE FAEKVGWRIP  240
REDDPEVQRF CGEVGVKRQV LKVWMHNNKA TSGKKQVQDS NESIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-242142691873ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007017558.12e-77Homeobox protein 33 isoform 1
RefseqXP_007017559.12e-77Homeobox protein 33 isoform 1
SwissprotQ9M9S01e-59ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLA0A118JZ111e-161A0A118JZ11_CYNCS; Homeodomain-like protein
STRINGSolyc04g080490.2.14e-73(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.14e-57homeobox protein 24